Protein Info for DDA3937_RS14215 in Dickeya dadantii 3937

Annotation: hydrogenase maturation factor HybG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 95 TIGR00074: hydrogenase assembly chaperone HypC/HupF" amino acids 1 to 78 (78 residues), 90.8 bits, see alignment E=1.9e-30 PF01455: HupF_HypC" amino acids 1 to 72 (72 residues), 87.1 bits, see alignment E=3.5e-29

Best Hits

Swiss-Prot: 68% identical to YFRC_PROVU: Frd operon uncharacterized protein C from Proteus vulgaris

KEGG orthology group: K04653, hydrogenase expression/formation protein HypC (inferred from 99% identity to dze:Dd1591_1418)

Predicted SEED Role

"[NiFe] hydrogenase metallocenter assembly protein HypC" in subsystem NiFe hydrogenase maturation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SKF9 at UniProt or InterPro

Protein Sequence (95 amino acids)

>DDA3937_RS14215 hydrogenase maturation factor HybG (Dickeya dadantii 3937)
MCLGVPGKVVAVGPDLHYPARVDVCGVQREVNIALVCEGDPAELVGQWVLVHVGFAMSLL
DEQEAQETLAALQSMQAVGLELDEVRQTGAIYAVR