Protein Info for DDA3937_RS13885 in Dickeya dadantii 3937

Annotation: type IV secretion system DNA-binding domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 587 transmembrane" amino acids 7 to 23 (17 residues), see Phobius details amino acids 29 to 47 (19 residues), see Phobius details amino acids 60 to 81 (22 residues), see Phobius details amino acids 98 to 119 (22 residues), see Phobius details PF01935: DUF87" amino acids 173 to 275 (103 residues), 25.4 bits, see alignment E=2.8e-09 PF10412: TrwB_AAD_bind" amino acids 302 to 542 (241 residues), 30.2 bits, see alignment E=4.5e-11 PF02534: T4SS-DNA_transf" amino acids 346 to 537 (192 residues), 25.8 bits, see alignment E=1e-09 PF12696: TraG-D_C" amino acids 400 to 493 (94 residues), 29.3 bits, see alignment E=1.5e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to ddd:Dda3937_04293)

Predicted SEED Role

"MobB protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SJJ2 at UniProt or InterPro

Protein Sequence (587 amino acids)

>DDA3937_RS13885 type IV secretion system DNA-binding domain-containing protein (Dickeya dadantii 3937)
MLSNKLAVSLSPIVNGMLALLMFTQQHQLMLALLSGLTLPFFASMKSGERQTASFWKKGI
IAFSLLCFLFGTMAPVIIRFFQWVYQTRIVTRYSLATWPIRIILTATGIIFHIILRRALT
PELDKIKKRLVKKTTLERELRTDVRTVRSLLPETLHYDPLDYIDLHNGIFLGMDRDKQPM
YLPLNDWQKQHADIIGTTGAGKGVAAGILLYQSILAGEGVFIMDPKDDEWAPHLYRKACE
DAGKPFALIDLRKPHYQLNLIEAITADELEELFVAGFSLAEKGQESDFYRIDDRKAARIA
AQLVSNRPSSTIRDIYNSEYVQSIAEKIKAFFGKLEELALLNAINAPTGFSLQSVFDEGG
CCYVIGSMRNSKIITAQRMLLVRLYQLAERRDRVHIAPRPVAIFLDELKYHLSKPALEGL
GAARDKGVHIIMTHQSVADLKDCPADLSGDAVVGAIVENAKFKLVYRVMDPDTAEWVARM
SGTILVDDEIRKAKTDAVLTETIDNERTIRQAERFFIDGNMILNLPDFVSFIFTTKTLPS
ASLISPIQVQKHALETFTVSPDIAASAAPVKQALDFSEEENVPQIDF