Protein Info for DDA3937_RS13865 in Dickeya dadantii 3937

Annotation: P-type conjugative transfer protein VirB9

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR02781: P-type conjugative transfer protein VirB9" amino acids 8 to 277 (270 residues), 240.5 bits, see alignment E=1.1e-75 PF03524: CagX" amino acids 31 to 275 (245 residues), 171.1 bits, see alignment E=1.5e-54

Best Hits

KEGG orthology group: K03204, type IV secretion system protein VirB9 (inferred from 100% identity to ddd:Dda3937_02747)

Predicted SEED Role

"Forms the bulk of type IV secretion complex that spans outer membrane and periplasm (VirB9)" in subsystem Type 4 secretion and conjugative transfer

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SJI7 at UniProt or InterPro

Protein Sequence (297 amino acids)

>DDA3937_RS13865 P-type conjugative transfer protein VirB9 (Dickeya dadantii 3937)
MMLKNTVLTGLMLASCAVWGAAIPRGSAYDSRIQHVTYDSQNATVVNTRPGYLTTLLFDD
DEAVLDAQSGFPKGWRVTKSDNRVDVSPNPVIQPVTEDNGNNVNKVFLPTAKEWKTNLLV
VTSKREYSLELNVLDNDSPSQAFIIRFHYPDEARRQSAAADAAHLQRLREAQEKQQIAAA
FEQATTPRNWRYTKRVAADSAAIAPDFAYDDGRFITLGFSATKILPSLFRVVNQQEQTVT
PRITKHGNYTVMVVRAMSPHLVLRYGRAVVGIENTAFGNVAVSAGDTVSPAVTLEAK