Protein Info for DDA3937_RS13765 in Dickeya dadantii 3937

Annotation: type VI secretion system tip protein VgrG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 617 TIGR03361: type VI secretion system Vgr family protein" amino acids 9 to 518 (510 residues), 655 bits, see alignment E=7.7e-201 TIGR01646: Rhs element Vgr protein" amino acids 22 to 501 (480 residues), 483.9 bits, see alignment E=6.2e-149 PF05954: Phage_GPD" amino acids 30 to 328 (299 residues), 310.4 bits, see alignment E=1.3e-96 PF04717: Phage_base_V" amino acids 385 to 450 (66 residues), 52.2 bits, see alignment E=6.4e-18

Best Hits

Swiss-Prot: 100% identical to VGRGB_DICD3: Putative type VI secretion system protein VgrGB (vgrGB) from Dickeya dadantii (strain 3937)

KEGG orthology group: None (inferred from 100% identity to ddd:Dda3937_02771)

Predicted SEED Role

"VgrG-3 protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SIS4 at UniProt or InterPro

Protein Sequence (617 amino acids)

>DDA3937_RS13765 type VI secretion system tip protein VgrG (Dickeya dadantii 3937)
MANSTGLQFTVKVGALPDTTFAVVDFELSEALNQPFALSLNLASSQPGIDFGAVLDQPCE
LLVWYEGELQRRVSGIVSRFAQGDTGFRRTRYQAEVRPALWRLGLRTNARIFQTQKPDAI
ISTLLEEAGITDYAFALRHDHAVREYCVQYRESDLAFINRLAAEEGLFYFHEFEAGKHRV
VFADDAGALAKGPELFFNLATQGLSEGAYVRRFRYAEAVSTAEVALKDYSFKTPAYGLLH
NKMSSELAHQRESYQHFDYPGRFKQDPSGKAFTGYRLDALRAGAMTGNGESNAAELRPGS
SFTLTEHPNPAFNLAWQVVAVAHSGQQPQALEEESGGEPTTLSNSFEVVKATTTWRAALP
YKPMVDGPQIATVVGPAGEEIYCDEFGRVKLQFPWDRYGASDDQSSCWVRVSQGWAGGQY
GLIAIPRIGHEVVVSFLEGDPDQPIVTGRTFHATNPSPYPLPASKTRTSLRTSTHKGAGF
NELRFEDQAGQEEVFIHAQKDMNTVVLNNRSTSVNASHTENVGGDQTVVVQHNQTVSVKE
NQVTEIQGEQTVAVTKNRHTTVDDNESLQVKKNIAIQSQSGDVLIATAGGFIAIDKDGNI
SITGKGLVLNGTRIDLN