Protein Info for DDA3937_RS13735 in Dickeya dadantii 3937

Annotation: integrase arm-type DNA-binding domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 427 PF13356: Arm-DNA-bind_3" amino acids 3 to 87 (85 residues), 86.2 bits, see alignment E=1.4e-28 PF00589: Phage_integrase" amino acids 206 to 383 (178 residues), 66.8 bits, see alignment E=2.1e-22

Best Hits

Swiss-Prot: 55% identical to INTB_ECOLI: Putative protein IntB (intB) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to ddd:Dda3937_00080)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SIR8 at UniProt or InterPro

Protein Sequence (427 amino acids)

>DDA3937_RS13735 integrase arm-type DNA-binding domain-containing protein (Dickeya dadantii 3937)
MSLNDSKIRNLKPSAKPFKVSDSHGLYLLVNPGGSRLWYLKYRINRKESRLGLGTYPDVS
LADARQQRDGIRKLLAQNINPAHQRAAEKASRSPEKSFRDVALDWHKSNRTWSENHATRL
LASMNNYLFPVIGHLPVTELKPRHFIDLLRGIEKKGLLEVASRTRQHLCNIMRHAVHQEL
IEHNPAANLDGIIATPVKRHYPALPLEQLPELLTRIEDYRQGRELTRLAVSLTLHLFIRS
SELRFARWSEIDFRNNIWTIPATRKAIPGVRYSGRGAKMRTPHIVPLSRQTIAILRQIQE
ISRHQVLIFPGAHNPYKPMCENTVNKALRLMGYDTKDEICGHGFRAMACSALMESGLWSQ
DAVERQMSHQERNSVRAAYIHKAQYLDARKAMMQWWSDYLDMNREGYVAPYVYARECRER
AVNFIIG