Protein Info for DDA3937_RS13705 in Dickeya dadantii 3937

Annotation: UvrY/SirA/GacA family response regulator transcription factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 218 PF00072: Response_reg" amino acids 4 to 115 (112 residues), 104.9 bits, see alignment E=2.8e-34 PF00196: GerE" amino acids 148 to 203 (56 residues), 69.4 bits, see alignment E=1.6e-23

Best Hits

Swiss-Prot: 82% identical to UVRY_SHIFL: Response regulator UvrY (uvrY) from Shigella flexneri

KEGG orthology group: K07689, two-component system, NarL family, invasion response regulator UvrY (inferred from 100% identity to ddd:Dda3937_03960)

Predicted SEED Role

"BarA-associated response regulator UvrY (= GacA = SirA)" in subsystem Pseudomonas quinolone signal PQS or Quorum sensing regulation in Pseudomonas or Type III secretion system orphans

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SIR2 at UniProt or InterPro

Protein Sequence (218 amino acids)

>DDA3937_RS13705 UvrY/SirA/GacA family response regulator transcription factor (Dickeya dadantii 3937)
MISVFLVDDHELVRAGIRRILDDIKGLKVVGEAQCGEDAVRWCRNNSADVVLMDMNMPGI
GGLEATRKIVRFSPEIKVIMLTIHTENPLPAKVMQAGAAGYLSKGATPEEVICAIRSVHA
GKRYIASDIAQQMALSQLEPQAETPLECLSERELQIMMMITKGQKVTEISDQLNLSPKTV
NSYRYRMFSKLNINGDVELTHLAIRHGLFSAETLISSD