Protein Info for DDA3937_RS13700 in Dickeya dadantii 3937

Annotation: excinuclease ABC subunit UvrC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 610 TIGR00194: excinuclease ABC subunit C" amino acids 10 to 589 (580 residues), 757.2 bits, see alignment E=6.5e-232 PF01541: GIY-YIG" amino acids 18 to 93 (76 residues), 45.2 bits, see alignment E=2.3e-15 PF02151: UVR" amino acids 205 to 237 (33 residues), 37.2 bits, see alignment (E = 4.5e-13) PF08459: UvrC_RNaseH_dom" amino acids 386 to 542 (157 residues), 157.4 bits, see alignment E=7.1e-50 PF14520: HHH_5" amino acids 557 to 608 (52 residues), 30.5 bits, see alignment 1e-10

Best Hits

Swiss-Prot: 86% identical to UVRC_PECAS: UvrABC system protein C (uvrC) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K03703, excinuclease ABC subunit C (inferred from 100% identity to ddd:Dda3937_03959)

MetaCyc: 85% identical to UvrABC excision nuclease subunit C (Escherichia coli K-12 substr. MG1655)
3.1.25.-

Predicted SEED Role

"Excinuclease ABC subunit C" in subsystem DNA repair, UvrABC system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SIR1 at UniProt or InterPro

Protein Sequence (610 amino acids)

>DDA3937_RS13700 excinuclease ABC subunit UvrC (Dickeya dadantii 3937)
MTERFDAQAFLKTVTSQPGVYRMYDADDTVIYVGKAKDLKKRLSSYFRAQVASRKTEALV
KSIRQIDVTITHTETEALLLEHNYIKRYQPRYNVLLRDDKSYPLIFLSGDTHPRLSVHRG
AKHAKGEYFGPFPNGNAVRETLMLLQKLFPIRQCENSVYRNRSRPCLQYQIGRCLGPCVN
GLVSEEEYQRQVEYVRLFLLGKDQQVLTRLIERMETASRELRFEEAARIRDQIQAVRRVT
EKQFVSGDGDDLDVIGVAFEAGMACVHVLFIRQGKVLGSRSYFPKVPGGTELAEVVQTFV
GQFYLQGSVSRTLPSDILLDFSLPEHQLLAESLTEQAGRKIQIQTRPRGDRARYLKLART
NAHTALTTKLSQQSTVQQRLAALASVLGIEKINRMECFDISHTMGEQTVASCVVFNADGP
LRSEYRRYNIAGITPGDDYAAMNQVLRRRYGKSIDEGKVPDVIVIDGGKGQLAQAKEVFA
SLQVPWDKSRPLLLGVAKGSDRKAGLETLFFEATGEGVALPADSPALHVIQHIRDDSHNH
AISGHRKQRAKVKSTSSLETIEGVGPKRRQMLLKYMGGLQPLMNASVEDIANVPGISHAL
AEKIFHALKH