Protein Info for DDA3937_RS13595 in Dickeya dadantii 3937

Annotation: EmmdR/YeeO family multidrug/toxin efflux MATE transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 478 transmembrane" amino acids 36 to 60 (25 residues), see Phobius details amino acids 75 to 96 (22 residues), see Phobius details amino acids 116 to 139 (24 residues), see Phobius details amino acids 159 to 178 (20 residues), see Phobius details amino acids 186 to 206 (21 residues), see Phobius details amino acids 212 to 236 (25 residues), see Phobius details amino acids 250 to 272 (23 residues), see Phobius details amino acids 299 to 323 (25 residues), see Phobius details amino acids 343 to 367 (25 residues), see Phobius details amino acids 382 to 400 (19 residues), see Phobius details amino acids 411 to 431 (21 residues), see Phobius details amino acids 433 to 433 (1 residues), see Phobius details amino acids 437 to 458 (22 residues), see Phobius details PF01554: MatE" amino acids 39 to 199 (161 residues), 126.4 bits, see alignment E=4.6e-41 amino acids 269 to 430 (162 residues), 71.8 bits, see alignment E=2.8e-24 TIGR00797: MATE efflux family protein" amino acids 39 to 443 (405 residues), 216.7 bits, see alignment E=2.5e-68

Best Hits

Swiss-Prot: 64% identical to YEEO_ECOLI: Probable FMN/FAD exporter YeeO (yeeO) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to ddd:Dda3937_02791)

MetaCyc: 64% identical to FMN/FAD exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-272; TRANS-RXN0-595

Predicted SEED Role

"Putative sugar transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SIN7 at UniProt or InterPro

Protein Sequence (478 amino acids)

>DDA3937_RS13595 EmmdR/YeeO family multidrug/toxin efflux MATE transporter (Dickeya dadantii 3937)
MILNTAKQLLSTLRSTSWYKKRHSNRVLFWREITPLAVPIFIEGLCVVLMGIFSTFLVSW
LGKEAMAAVGLADSFNMLIIAFFTAVALGTAVVVAFSLGQRNRKQARQAARQSISLLVLI
SLLLVGLVEFAGQLIIDLIANNAEPTVKSLALTFLRLTVWGYPALAITLVGCGALRGAGN
TRLPMIINIGMNILNILLSGVLIYGVSSWQGVGFVGAGLGITLSRYLGALCVVLALTKGF
NGALRIPFQSYFAPFTTTILYEVLSIGIPASIESVMFNVGKLITQRFVAGMGTEVIAGNF
IAFSIAALINLPGNALGSTATIIVGSRLGKGQRMQPERQLKYIFWLSNVGLCALALFSVP
TAGLMASMYTNEPDVITVVKQLIWLNALFMPIWAASWVLPAGLKGAKDASYTMWVALAGM
WGCRVIAGYILGIMLGFGVIGVWMGMFLDWIVRGALFYQRMVSGKWLWRYKPSVNQDR