Protein Info for DDA3937_RS13500 in Dickeya dadantii 3937

Annotation: flagellar protein FlhE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 140 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 52 to 67 (16 residues), see Phobius details PF06366: FlhE" amino acids 34 to 140 (107 residues), 138.1 bits, see alignment E=5.5e-45

Best Hits

KEGG orthology group: K03516, flagellar protein FlhE (inferred from 100% identity to ddd:Dda3937_03966)

Predicted SEED Role

"Flagellar protein FlhE" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SIL6 at UniProt or InterPro

Protein Sequence (140 amino acids)

>DDA3937_RS13500 flagellar protein FlhE (Dickeya dadantii 3937)
MKKVLIAGFISLAAGAFSFSAHAQQGGWNTNLTGPSFQYKGALASSPALLPPSGLGVTAA
QSVTVIYWRYQLKSPAPIDLAVKLCAANRCVNLDGASGQTYGLQGVPANSEFRMLFYVPG
SGRMVTSVDVASNEISVNYK