Protein Info for DDA3937_RS13425 in Dickeya dadantii 3937

Annotation: flagellar type III secretion system protein FliR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 transmembrane" amino acids 15 to 33 (19 residues), see Phobius details amino acids 45 to 98 (54 residues), see Phobius details amino acids 128 to 150 (23 residues), see Phobius details amino acids 180 to 204 (25 residues), see Phobius details amino acids 211 to 236 (26 residues), see Phobius details PF01311: Bac_export_1" amino acids 14 to 245 (232 residues), 232.8 bits, see alignment E=2.1e-73 TIGR01400: flagellar biosynthetic protein FliR" amino acids 15 to 255 (241 residues), 245.8 bits, see alignment E=2.5e-77

Best Hits

Swiss-Prot: 67% identical to FLIR_PECCC: Flagellar biosynthetic protein FliR (fliR) from Pectobacterium carotovorum subsp. carotovorum

KEGG orthology group: K02421, flagellar biosynthetic protein FliR (inferred from 100% identity to ddd:Dda3937_02214)

Predicted SEED Role

"Flagellar biosynthesis protein FliR" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SIK1 at UniProt or InterPro

Protein Sequence (260 amino acids)

>DDA3937_RS13425 flagellar type III secretion system protein FliR (Dickeya dadantii 3937)
MVTLSSIDMIGWFNQFFWPLVRILALISTAPIFSERSITRRVKIGLGVLITIVITPSIPH
TSIPVFSAAGIWMLFQQVLIGVMLGFAMQLAFAAIRLAGEIIGLQMGLSFATFFDPSGGP
NMPVIARLMNLLALLLFLSMNGHLWLISLLVDSFHTIPISAEPISGNVFMTLAEAGGRIF
SNGLMLALPLITLLLTINMALGLLSRLAPQLTIFAIGFPITLFAGIITVGFLIFLLSPYA
EKLFGETYDLLADLLSRFVG