Protein Info for DDA3937_RS12880 in Dickeya dadantii 3937

Annotation: aliphatic sulfonates ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 PF00005: ABC_tran" amino acids 32 to 165 (134 residues), 108.6 bits, see alignment E=2.1e-35

Best Hits

Swiss-Prot: 77% identical to SSUB_PECAS: Aliphatic sulfonates import ATP-binding protein SsuB (ssuB) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K02049, sulfonate/nitrate/taurine transport system ATP-binding protein (inferred from 100% identity to ddd:Dda3937_03508)

MetaCyc: 74% identical to aliphatic sulfonate ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-56-RXN [EC: 7.6.2.14]

Predicted SEED Role

"Alkanesulfonates ABC transporter ATP-binding protein / Sulfonate ABC transporter, ATP-binding subunit SsuB" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SGW3 at UniProt or InterPro

Protein Sequence (263 amino acids)

>DDA3937_RS12880 aliphatic sulfonates ABC transporter ATP-binding protein (Dickeya dadantii 3937)
MTFNHAAPARLNAGTPLLINGVTKRYGQRTILNDVHLHIPAGQFVAVVGRSGCGKSTLLR
LLAGLEQASHGELLAGRAPLRQARDDIRLMFQEARLLPWKRVLDNVGLGLRGEWRTAAHQ
ALDAVGLSSRAADWPAALSGGQKQRVALARALIHRPGLLLLDEPLGALDALTRIEMQGLI
ESLWLQQGFTVLLVTHDVSEAVALADRVILIEEGRVGLDVAIDLPRPRRRGSARLAELEA
QVLERILTPAVSRDTPYQTQAHA