Protein Info for DDA3937_RS12800 in Dickeya dadantii 3937

Annotation: AI-2E family transporter YdiK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 38 to 54 (17 residues), see Phobius details amino acids 66 to 90 (25 residues), see Phobius details amino acids 162 to 181 (20 residues), see Phobius details amino acids 203 to 273 (71 residues), see Phobius details amino acids 279 to 299 (21 residues), see Phobius details amino acids 309 to 340 (32 residues), see Phobius details PF01594: AI-2E_transport" amino acids 16 to 346 (331 residues), 166.3 bits, see alignment E=5.2e-53

Best Hits

Swiss-Prot: 68% identical to YDIK_SHIFL: Putative transport protein YdiK (ydiK) from Shigella flexneri

KEGG orthology group: None (inferred from 100% identity to ddd:Dda3937_04621)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SGU6 at UniProt or InterPro

Protein Sequence (366 amino acids)

>DDA3937_RS12800 AI-2E family transporter YdiK (Dickeya dadantii 3937)
MKQSPSQRFDLARILFSLLFIGILIIACFWVVQPFILGFAWASMVVVATWPLLIRLQQML
WGSRSLAVLVMTLLLVLLFVFPTSILVSSVIDNASNLISWIGAQGRITPPELDWLQSIPL
VGAKLHSSWHSLAHSGGPALMAKIQPYIGQTASWVVSQAAHIGRFLMHCTLMVLFSVLLY
SKGDQVALGVRRFAIRLGRQGGDSAVILAAQAIRAVALGVVVTAIVQSVLGGIGLALAGI
PYTTLLTVLMFLSCVAQIGPLTVLIPAIIWLYWSGDTTWGTILLIWSCVVGTLDNIIRPL
LIRMGADLPMLLILSGVIGGLLAFGMIGLFIGPVVLAVSYRLLSAWMKESPEPPPIRTIS
HHHKKP