Protein Info for DDA3937_RS12780 in Dickeya dadantii 3937

Annotation: Fe-S cluster assembly scaffold SufA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 123 TIGR01997: FeS assembly scaffold SufA" amino acids 18 to 123 (106 residues), 140.2 bits, see alignment E=2.7e-45 PF01521: Fe-S_biosyn" amino acids 19 to 118 (100 residues), 66.6 bits, see alignment E=1.2e-22 TIGR00049: iron-sulfur cluster assembly accessory protein" amino acids 19 to 122 (104 residues), 108.1 bits, see alignment E=2.4e-35

Best Hits

Swiss-Prot: 61% identical to SUFA_ECOLI: Protein SufA (sufA) from Escherichia coli (strain K12)

KEGG orthology group: K05997, Fe-S cluster assembly protein SufA (inferred from 100% identity to ddd:Dda3937_03669)

Predicted SEED Role

"Iron binding protein SufA for iron-sulfur cluster assembly"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SGU2 at UniProt or InterPro

Protein Sequence (123 amino acids)

>DDA3937_RS12780 Fe-S cluster assembly scaffold SufA (Dickeya dadantii 3937)
MQTHDVETFSLDEQAWQGLTLTDSAVAHISNLMRRDESVQGIRLAVKQSGCAGFGYVLEL
VHQPDPSDRLYQREGARLFIPLKAMPFLDGTEVDFVQEGINQVFKFNNPKARHACGCGES
FGL