Protein Info for DDA3937_RS12775 in Dickeya dadantii 3937

Annotation: Fe-S cluster assembly protein SufB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 499 TIGR01980: FeS assembly protein SufB" amino acids 21 to 490 (470 residues), 634.2 bits, see alignment E=5.2e-195 PF19295: SufBD_N" amino acids 162 to 221 (60 residues), 48.6 bits, see alignment E=7.8e-17 PF01458: SUFBD" amino acids 238 to 470 (233 residues), 232.1 bits, see alignment E=6.4e-73

Best Hits

Swiss-Prot: 84% identical to SUFB_ECOLI: FeS cluster assembly protein SufB (sufB) from Escherichia coli (strain K12)

KEGG orthology group: K09014, Fe-S cluster assembly protein SufB (inferred from 100% identity to ddd:Dda3937_03668)

Predicted SEED Role

"Iron-sulfur cluster assembly protein SufB" in subsystem Staphylococcal phi-Mu50B-like prophages

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SGU1 at UniProt or InterPro

Protein Sequence (499 amino acids)

>DDA3937_RS12775 Fe-S cluster assembly protein SufB (Dickeya dadantii 3937)
MARSNVDVSDDVQTWLDDGRYKEGFFTELAMDQLAHGINEDVVRAISARRNEPEWMLEFR
LSAYRAWLQMEEPHWLKAHYERLNYQDYSYYSAPSCGQCDDSCGSQPGAQQQPAGDAAHG
NYLTREVEDAFDKLGVPVREGKDVAVDAIFDSVSVATTYRDELAQQGIIFCSFSEAIQAH
PELVRQYLGTVVPANDNFFAALNAAVASDGTFVYIPKGVRCPMELSTYFRINAAKTGQFE
RTILIADDDSYVSYIEGCSAPVRDSYQLHAAVVEVIVNKNAEVKYSTVQNWFAGQGSEGG
ILNFVTKRALCAGDHSRMSWTQSETGSAITWKYPSVILRGDYSVGEFFSVALTSGHQQAD
TGTKMIHIGKNTRSTIIAKGISAGHSENTYRGLVKIMSSATNARNFTQCDSMLIGGDCGA
HTFPYVEVRNNSAQLEHEATTSRIGEDQLFYCLQRGISEDDAISMIVNGFCKDVFSELPL
EFAVEAQKLLSISLEHSVG