Protein Info for DDA3937_RS12610 in Dickeya dadantii 3937

Annotation: Grx4 family monothiol glutaredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 116 TIGR00365: monothiol glutaredoxin, Grx4 family" amino acids 6 to 102 (97 residues), 154.5 bits, see alignment E=3.4e-50 PF00462: Glutaredoxin" amino acids 18 to 82 (65 residues), 73.5 bits, see alignment E=6.4e-25

Best Hits

Swiss-Prot: 90% identical to GLRX4_ECO57: Glutaredoxin 4 (grxD) from Escherichia coli O157:H7

KEGG orthology group: K07390, monothiol glutaredoxin (inferred from 100% identity to ddd:Dda3937_00093)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SG28 at UniProt or InterPro

Protein Sequence (116 amino acids)

>DDA3937_RS12610 Grx4 family monothiol glutaredoxin (Dickeya dadantii 3937)
MTTTTLEKIQLQIAENPILLYMKGSPKLPSCGFSAQAVQALSACGERFAYVDILQNPDIR
AELPKYANWPTFPQLWVDGELVGGCDIVIEMYQRGELQQLIKETADKYRSQPAEQQ