Protein Info for DDA3937_RS12575 in Dickeya dadantii 3937

Annotation: pyridoxamine 5'-phosphate oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00558: pyridoxamine 5'-phosphate oxidase
  • amino acids 6 to 220 (215 residues), 322.5 bits, E=6e-101
• PF01243: Putative_PNPOx
  • amino acids 41 to 123 (83 residues), 80.6 bits, E=7.7e-27
• PF10590: PNP_phzG_C
  • amino acids 180 to 220 (41 residues), 72.9 bits, 1.5e-24

Best Hits

Swiss-Prot: 84% identical to PDXH_PECAS: Pyridoxine/pyridoxamine 5'-phosphate oxidase (pdxH) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K00275, pyridoxamine 5'-phosphate oxidase [EC: 1.4.3.5] (inferred from 94% identity to dze:Dd1591_1726)

MetaCyc: 80% identical to pyridoxine/pyridoxamine 5'-phosphate oxidase (Escherichia coli K-12 substr. MG1655)
Pyridoxal 5'-phosphate synthase. [EC: 1.4.3.5]; 1.4.3.5 [EC: 1.4.3.5]

Predicted SEED Role

"Pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 1.4.3.5)

MetaCyc Pathways

• superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (12/12 steps found)
• pyridoxal 5'-phosphate biosynthesis I (7/7 steps found)
• pyridoxal 5'-phosphate salvage I (6/6 steps found)
• pyridoxal 5'-phosphate salvage II (plants) (8/9 steps found)
• 4-amino-2-methyl-5-diphosphomethylpyrimidine biosynthesis II (5/8 steps found)

KEGG Metabolic Maps

• Vitamin B6 metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.3.5

Protein Sequence (220 amino acids)

>DDA3937_RS12575 pyridoxamine 5'-phosphate oxidase (Dickeya dadantii 3937)
MASGENTAAVDIADLRREYTRGGLRRHDLTDNPLDLFERWLKQACEAQLADPTAMCVATV
DEQGQPYQRIVLLKHYDEKGMVFYTNMGSRKAQQLAMNSRISLLFPWHMLERQVIVLGKA
EKLPMLDVMKYFHSRPRDSQIGAWVSKQSSRISARSMLESKFFEMKQKFQQGEIPLPSFW
GGFRVTIESMEFWQGGEHRLHDRFLYQREGEGWTIDRLAP