Protein Info for DDA3937_RS12545 in Dickeya dadantii 3937

Annotation: GTP cyclohydrolase II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00925: GTP_cyclohydro2
  • amino acids 5 to 170 (166 residues), 229.4 bits, E=9e-73
• TIGR00505: GTP cyclohydrolase II
  • amino acids 5 to 194 (190 residues), 305.6 bits, E=5.6e-96

Best Hits

Swiss-Prot: 92% identical to RIBA_KLEP3: GTP cyclohydrolase-2 (ribA) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K01497, GTP cyclohydrolase II [EC: 3.5.4.25] (inferred from 100% identity to ddd:Dda3937_04041)

MetaCyc: 90% identical to GTP cyclohydrolase 2 (Escherichia coli K-12 substr. MG1655)
GTP cyclohydrolase II. [EC: 3.5.4.25]

Predicted SEED Role

"GTP cyclohydrolase II (EC 3.5.4.25)" in subsystem Molybdenum cofactor biosynthesis or Riboflavin, FMN and FAD metabolism (EC 3.5.4.25)

MetaCyc Pathways

• flavin biosynthesis I (bacteria and plants) (9/9 steps found)
• flavin biosynthesis III (fungi) (8/9 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis III (Chlamydia) (3/5 steps found)
• toxoflavin biosynthesis (4/7 steps found)
• flavin biosynthesis II (archaea) (6/10 steps found)

KEGG Metabolic Maps

• Riboflavin metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.5.4.25

Use Curated BLAST to search for 3.5.4.25

Sequence Analysis Tools

See E0SG15 at UniProt or InterPro

Protein Sequence (197 amino acids)

>DDA3937_RS12545 GTP cyclohydrolase II (Dickeya dadantii 3937)
MQLKRVAEAKLPTPWGDFLMVGFEETATGRDHLALVYGDISSPEPVLARVHSECLTGDAL
FSLRCDCGFQLEAALNHIAEEGRGVLLYHRQEGRNIGLLNKIRAYALQDQGADTVEANHQ
LGFAADERDFTLCADMFKLLNVEAVRLLTNNPKKVAILSEAGINIVERVPLIVGRNPKNE
HYLATKAAKMGHLLDTK