Protein Info for DDA3937_RS12515 in Dickeya dadantii 3937

Annotation: osmotically-inducible lipoprotein OsmB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 71 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF05433: Rick_17kDa_Anti" amino acids 32 to 69 (38 residues), 29.8 bits, see alignment E=2.2e-11

Best Hits

Swiss-Prot: 68% identical to OSMB_ECO57: Osmotically-inducible lipoprotein B (osmB) from Escherichia coli O157:H7

KEGG orthology group: K04062, osmotically inducible lipoprotein OsmB (inferred from 96% identity to dze:Dd1591_1738)

Predicted SEED Role

"Osmotically inducible lipoprotein B precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SG09 at UniProt or InterPro

Protein Sequence (71 amino acids)

>DDA3937_RS12515 osmotically-inducible lipoprotein OsmB (Dickeya dadantii 3937)
MQINKKFTTAVLAMVIVSTLAGCAGMNKRQRNTAIGAGIGALGGAVLTNGSALGTVGGAA
VGGVIGHQTTK