Protein Info for DDA3937_RS12450 in Dickeya dadantii 3937

Annotation: peptide ABC transporter permease SapC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 transmembrane" amino acids 31 to 54 (24 residues), see Phobius details amino acids 99 to 122 (24 residues), see Phobius details amino acids 142 to 169 (28 residues), see Phobius details amino acids 200 to 217 (18 residues), see Phobius details amino acids 224 to 241 (18 residues), see Phobius details amino acids 261 to 283 (23 residues), see Phobius details PF12911: OppC_N" amino acids 14 to 66 (53 residues), 55.7 bits, see alignment 3.5e-19 PF00528: BPD_transp_1" amino acids 113 to 291 (179 residues), 74.7 bits, see alignment E=8e-25

Best Hits

Swiss-Prot: 71% identical to SAPC_SALTY: Peptide transport system permease protein SapC (sapC) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 100% identity to ddd:Dda3937_03111)

MetaCyc: 70% identical to putrescine ABC exporter membrane protein SapC (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-328 [EC: 7.6.2.16]

Predicted SEED Role

"Peptide transport system permease protein sapC (TC 3.A.1.5.5)" in subsystem ABC transporter peptide (TC 3.A.1.5.5) (TC 3.A.1.5.5)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SFZ7 at UniProt or InterPro

Protein Sequence (296 amino acids)

>DDA3937_RS12450 peptide ABC transporter permease SapC (Dickeya dadantii 3937)
MHSDNIYGEKELPSRWRDTWNVFRQDRMAMVGFYGFLLLLGLCLFGDTLAPYALDQQFLG
YQLLPPSWSRYGEVSFFLGTDDLGRDLLSRLLSGTAPTFGSALLVTLAAMLAGILIGLLA
GVTHGLRSAILNHILDPLLSIPSLLLAMVVIAFIGPQLTHAMLAVWMALLPRMVRTIYTA
VHDELEKEYVTAARLDGASTRYIIWYAVVPNILPLLVSEVTRALSIAILDIAALGFLNLG
AQLPTTEWGVLLGNSLELVYAAPWTVMLPGAAITLSVLIVNLLGDGIRRALLAQTE