Protein Info for DDA3937_RS12345 in Dickeya dadantii 3937

Annotation: murein tripeptide amidase MpaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 243 PF00246: Peptidase_M14" amino acids 41 to 161 (121 residues), 42.2 bits, see alignment E=7.9e-15 PF24827: AstE_AspA_cat" amino acids 47 to 109 (63 residues), 30.9 bits, see alignment E=2e-11

Best Hits

Swiss-Prot: 70% identical to MPAA_ECO57: Murein peptide amidase A (mpaA) from Escherichia coli O157:H7

KEGG orthology group: K14054, protein MpaA (inferred from 100% identity to ddd:Dda3937_03135)

MetaCyc: 70% identical to murein tripeptide amidase A (Escherichia coli K-12 substr. MG1655)
RXN0-961

Predicted SEED Role

"Gamma-D-Glutamyl-meso-Diaminopimelate Amidase"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SFX3 at UniProt or InterPro

Protein Sequence (243 amino acids)

>DDA3937_RS12345 murein tripeptide amidase MpaA (Dickeya dadantii 3937)
MTDAEFLHRPRTERGFFTSPGQEYGRSRLGAPLLWFPAEVEGKHSGLILAGTHGDETASV
VALSCALRTLAPGSRAHHVVLAVNPDGCQLGLRANAGGVDLNRNFPAANWQPDGTVYRWS
EDTPVRDVQISTGDRPGSEPETQALCRLIDRLSPPWVVSFHEPLACIDDPHRSELGGWLA
REFALPLVDSVGYPTPGSFGSWCAERRLHCITAELPVIAADSANHRYLTALTRLLSHNFL
YQC