Protein Info for DDA3937_RS12150 in Dickeya dadantii 3937

Annotation: diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 604 PF01590: GAF" amino acids 29 to 152 (124 residues), 48.3 bits, see alignment E=6.1e-16 PF13185: GAF_2" amino acids 77 to 156 (80 residues), 30.8 bits, see alignment E=1.2e-10 TIGR00229: PAS domain S-box protein" amino acids 183 to 301 (119 residues), 54 bits, see alignment E=1.9e-18 amino acids 321 to 434 (114 residues), 28.4 bits, see alignment E=1.6e-10 PF00989: PAS" amino acids 184 to 290 (107 residues), 28.2 bits, see alignment E=6.3e-10 PF13426: PAS_9" amino acids 192 to 293 (102 residues), 37.5 bits, see alignment E=1e-12 PF08447: PAS_3" amino acids 203 to 280 (78 residues), 42.6 bits, see alignment E=2.3e-14 PF08448: PAS_4" amino acids 331 to 434 (104 residues), 33.8 bits, see alignment E=1.4e-11 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 444 to 599 (156 residues), 131.6 bits, see alignment E=2.4e-42 PF00990: GGDEF" amino acids 446 to 601 (156 residues), 146.4 bits, see alignment E=2.7e-46

Best Hits

KEGG orthology group: None (inferred from 100% identity to ddd:Dda3937_00104)

Predicted SEED Role

"FIG00614051: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SF46 at UniProt or InterPro

Protein Sequence (604 amino acids)

>DDA3937_RS12150 diguanylate cyclase (Dickeya dadantii 3937)
MTSPCHRCSEEQQDILARMLNIFDTQPAEELPRLTRITRTFFQVKSVVISLVNNERQWFL
SKANFPFQEPAIEFSFCVHTVSVNAPLVIPDTLQDPRFATNPLVTGDEPIRFHAGYPLRS
SLGTPLGALCLYHDQPRAFSDEDMQQLSDLAFIVQTVLHKVEMQAREAIAQERLYHSDYI
SQQIFSRAAIGLALIAPDKRPLKFNHAFCDMLGYDEETLLTLPVDKVVHPEDMPQLISDH
NLLMDNNLLESTQQRRYIRADGSELWAQVSISVLYHPDGAKFGLLLALTDLSDQKASEQA
LRDLSQELEHRVEQRTAELRQSHQFIQDITDHIPAMISCINPNNVLVFANRHLRKLIGFE
HDSLYQRDIHEILRPQELALFLPRLEESRQKRHPASFEHVLDMPDGQLTTFHTELVPADS
PELGTYILSTDITHLTVLRDQLTFEANHDHLTGLPNRRAVISYLNRLAGKKRRGALALLF
FDINNFKHYNDQFGHDFGDRVIKTFARLLRQNTRSYDFIGRLAGDEFLMVIHEQRNLANE
IRAITQKLKAKFEKPITIRQQTITLSASVGRAILPQGAPLNANELIRQADTAMYQAKRRH
TSPS