Protein Info for DDA3937_RS11815 in Dickeya dadantii 3937

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 transmembrane" amino acids 37 to 60 (24 residues), see Phobius details amino acids 207 to 229 (23 residues), see Phobius details amino acids 239 to 262 (24 residues), see Phobius details amino acids 290 to 311 (22 residues), see Phobius details amino acids 319 to 338 (20 residues), see Phobius details amino acids 343 to 367 (25 residues), see Phobius details amino acids 387 to 411 (25 residues), see Phobius details PF00528: BPD_transp_1" amino acids 222 to 410 (189 residues), 30.9 bits, see alignment E=1.1e-11

Best Hits

KEGG orthology group: K02054, putative spermidine/putrescine transport system permease protein (inferred from 100% identity to ddd:Dda3937_00640)

Predicted SEED Role

"Spermidine Putrescine ABC transporter permease component PotB (TC 3.A.1.11.1)" in subsystem Polyamine Metabolism (TC 3.A.1.11.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SE93 at UniProt or InterPro

Protein Sequence (423 amino acids)

>DDA3937_RS11815 ABC transporter permease (Dickeya dadantii 3937)
MSQNEIVKTEPPAGGEGNRTSLKQQLRQAQARYQKRSLLLIAPLFLFILVSFLFPILSIL
GKSVSNPDLRVSMPTTIEAMRQWSGKGVPDESVFRALVSDLRNARSTGQVATITKRLGYE
DGQYRQLITRTLRKLPSDEQPGLREQLIADQPMWGELTTWKTIDRASRPFTSYYLLSVFD
HKVDPQTDKVVAQPADQALYVDVLLRTLLMAGVVTLLCVALGYPLAYWLAKQPDNRANLL
MILVLLPFWTSLIVRTASWIVLLQSGGLINRSLMGLGIIDEPLVLVFNRIGVYISMTHIL
LPFFVLPLYAVMKGISPNYVRAAISLGAHPFLAFWRVYVPQTYAGVTAGALLVFMMAIGY
YITPALLGGPGDQMLSYFVAFFTNTTMNWGMAAALGTQLLVIVVLLYVVYIRVTRTDADA
AAR