Protein Info for DDA3937_RS11810 in Dickeya dadantii 3937

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 272 transmembrane" amino acids 15 to 39 (25 residues), see Phobius details amino acids 73 to 96 (24 residues), see Phobius details amino acids 105 to 130 (26 residues), see Phobius details amino acids 138 to 161 (24 residues), see Phobius details amino acids 190 to 217 (28 residues), see Phobius details amino acids 239 to 261 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 85 to 266 (182 residues), 59 bits, see alignment E=2.6e-20

Best Hits

KEGG orthology group: K02053, putative spermidine/putrescine transport system permease protein (inferred from 100% identity to ddd:Dda3937_00639)

Predicted SEED Role

"Spermidine Putrescine ABC transporter permease component potC (TC_3.A.1.11.1)" in subsystem Polyamine Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SE92 at UniProt or InterPro

Protein Sequence (272 amino acids)

>DDA3937_RS11810 ABC transporter permease (Dickeya dadantii 3937)
MRQQGSQLLRVWNGFFNFYGAAMLLFLIVPVLVIVPLSFNGGSFLSYPLAGFSLRWYREF
FHSSEWLSALGNSLLIAPLATVLATVLGVLASVGLVRGEFRGKSLVMAVLISPMIAPVVI
VAVGMFFFFAKLSLLNSYIGLVLAHAVLGVPFVVITVTAVLKNYDQNLTRAAASLGAPPL
LAFRKVTLPLIAPGVFSGALFAFATSFDEVIVTLFLASPRQRTLPLQMFAGIRENLDPTI
AAAATMMVAAALVLLVVMEILRRRSEKLRGGR