Protein Info for DDA3937_RS11705 in Dickeya dadantii 3937

Annotation: type III secretion system export apparatus subunit SctT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 transmembrane" amino acids 13 to 36 (24 residues), see Phobius details amino acids 46 to 64 (19 residues), see Phobius details amino acids 80 to 99 (20 residues), see Phobius details amino acids 135 to 154 (20 residues), see Phobius details amino acids 188 to 212 (25 residues), see Phobius details amino acids 219 to 242 (24 residues), see Phobius details TIGR01401: type III secretion apparatus protein SpaR/YscT/HrcT" amino acids 8 to 257 (250 residues), 211.8 bits, see alignment E=6e-67 PF01311: Bac_export_1" amino acids 15 to 242 (228 residues), 150.3 bits, see alignment E=3.5e-48

Best Hits

KEGG orthology group: K03228, type III secretion protein SctT (inferred from 100% identity to ddd:Dda3937_00617)

Predicted SEED Role

"Type III secretion inner membrane protein (YscT,HrcT,SpaR,EscT,EpaR1,homologous to flagellar export components)" in subsystem Type III secretion systems, extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SE68 at UniProt or InterPro

Protein Sequence (267 amino acids)

>DDA3937_RS11705 type III secretion system export apparatus subunit SctT (Dickeya dadantii 3937)
MLSIATIQNIYDFIYALTLGVARLYPCLFLVPLFSFTIIKGMLRNAVAIALALVPAGAIQ
QQMLTTTITWPMLPGLLLKELVIGLLLGVVLAMPFWLFESVGALFDNQRGALTGGQLNPA
LGSDATPLGHMMKELFMMMLIITIGFPGFTQLLWDSYRLWPALDFLPPLSEQGFHTYLDL
LKDTFQHMIVYAGPLVALLLLLEFSIAILSLYSPQLQVYVLSTPAKCLAGMAFFVLYMPV
LQFLGEGRLKALSDLKHLLPLFFQASP