Protein Info for DDA3937_RS11695 in Dickeya dadantii 3937

Annotation: type III secretion system export apparatus subunit SctR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 54 to 73 (20 residues), see Phobius details amino acids 136 to 150 (15 residues), see Phobius details amino acids 160 to 182 (23 residues), see Phobius details amino acids 192 to 215 (24 residues), see Phobius details TIGR01102: type III secretion apparatus protein, YscR/HrcR family" amino acids 12 to 212 (201 residues), 293.3 bits, see alignment E=4.9e-92 PF00813: FliP" amino acids 15 to 212 (198 residues), 208.5 bits, see alignment E=4.8e-66

Best Hits

Swiss-Prot: 79% identical to HRCR_ERWAM: Harpin secretion protein HrcR (hrcR) from Erwinia amylovora

KEGG orthology group: K03226, type III secretion protein SctR (inferred from 100% identity to ddd:Dda3937_00615)

Predicted SEED Role

"Type III secretion inner membrane protein (YscR,SpaR,HrcR,EscR,homologous to flagellar export components)" in subsystem Type III secretion systems, extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SE66 at UniProt or InterPro

Protein Sequence (217 amino acids)

>DDA3937_RS11695 type III secretion system export apparatus subunit SctR (Dickeya dadantii 3937)
MTSGSFDPVMFALFLGALSLIPLMMIVCTCFLKVSMVLMITRNAIGVQQVPPNMALYGIA
LAATLFVMAPVFSDIKQRFQDAPVDFSSLDALESSVTKGIEPLQKFMSRNTDPDILTHLH
ENSLRMWPASMSEKITTQNILLVLPAYVLSELQAGFKIGFLIYIPFIVIDLIVSNVLLAL
GMQMVAPTTLSLPLKLLLFVLVNGWTRLLDGLFYSYL