Protein Info for DDA3937_RS11645 in Dickeya dadantii 3937

Annotation: response regulator transcription factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 213 transmembrane" amino acids 160 to 178 (19 residues), see Phobius details PF00072: Response_reg" amino acids 8 to 119 (112 residues), 93.3 bits, see alignment E=1.1e-30 PF00196: GerE" amino acids 151 to 206 (56 residues), 60.2 bits, see alignment E=1.2e-20

Best Hits

Swiss-Prot: 32% identical to GACA_PSEPH: Response regulator GacA (gacA) from Pseudomonas protegens (strain DSM 19095 / LMG 27888 / CHA0)

KEGG orthology group: None (inferred from 100% identity to ddd:Dda3937_03346)

Predicted SEED Role

"DNA-binding response regulator, LuxR family, near polyamine transporter" in subsystem Polyamine Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SE56 at UniProt or InterPro

Protein Sequence (213 amino acids)

>DDA3937_RS11645 response regulator transcription factor (Dickeya dadantii 3937)
MDRLIKLMIADDHVIMREGLKQIFALDDNLEVVAEAGTGSQVLAQLRESQVDLLLLDMSM
PGICGEELIIRIVAQYPRLPILVLSMYSEPQIARRVLKSGALGYITKDKDPEALLSAIRR
VAQGARYIDHSIAEQIVFADCQTRGDGRNELLTSREHQIMVMLAQGLGVNAIAEMLAISN
KTVSTHKSRLMEKMQFTTNADIVKYALSQRLIA