Protein Info for DDA3937_RS11505 in Dickeya dadantii 3937

Annotation: two-component system sensor histidine kinase PhoQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 487 transmembrane" amino acids 14 to 40 (27 residues), see Phobius details amino acids 193 to 213 (21 residues), see Phobius details PF08918: PhoQ_Sensor" amino acids 9 to 187 (179 residues), 291.4 bits, see alignment E=5.8e-91 PF00672: HAMP" amino acids 212 to 261 (50 residues), 23.7 bits, see alignment 9.6e-09 PF02518: HATPase_c" amino acids 377 to 475 (99 residues), 59.7 bits, see alignment E=7.4e-20 PF14501: HATPase_c_5" amino acids 377 to 462 (86 residues), 26 bits, see alignment E=1.5e-09

Best Hits

KEGG orthology group: K07637, two-component system, OmpR family, sensor histidine kinase PhoQ [EC: 2.7.13.3] (inferred from 100% identity to ddd:Dda3937_02089)

Predicted SEED Role

"Sensor protein PhoQ (EC 2.7.13.3)" in subsystem Lipid A modifications (EC 2.7.13.3)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SDF9 at UniProt or InterPro

Protein Sequence (487 amino acids)

>DDA3937_RS11505 two-component system sensor histidine kinase PhoQ (Dickeya dadantii 3937)
MDDILKKSPFSLRFRFLIATAAVVLALTLSYGIVAVVGYSVSFDKTSFRLLRGESNLFYS
LAQWHDNQLTIATPPEIDINYPTLVFIYDKHGKLLWRERAVPELESQIKPEWLEKTDYHE
LDADTNTSNAVLQGSNPQMLDKLHAYSSEDKTPFTHSIAVNVYPASERLPKMVIVVVDRV
PQELQQADVVWEWFRYVFIAHLVLVLPLLWLAAHWSLRPIKHLVHQISELEHGSREHLDE
NPPRELNSLVRNLNTLLSNERQRYHKYRTTLTDLTHSLKTPLAVLQTTLRSLRTGKELTI
EQAEPIMLTQISRISQQIGYYLHRASVRTEHLTITREVHSVPAQLDALCSALNKVYQRKG
VVLTMDIAPELTFIGEKNDFMEVMGNILDNACKYCLEFVEISARYSGQKLHLVIEDDGPG
IPDSKRELIFQRGQRADTLRPGQGIGLSVAAEIIEQYQGEILIGTSALGGAKVEAIFGRQ
HLGQNEN