Protein Info for DDA3937_RS11475 in Dickeya dadantii 3937

Annotation: 23S rRNA pseudouridine(2457) synthase RluE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 218 PF00849: PseudoU_synth_2" amino acids 40 to 186 (147 residues), 66.8 bits, see alignment E=1.3e-22 TIGR00093: pseudouridine synthase" amino acids 45 to 216 (172 residues), 180.5 bits, see alignment E=1e-57

Best Hits

Swiss-Prot: 68% identical to RLUE_SALTY: Ribosomal large subunit pseudouridine synthase E (rluE) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K06181, ribosomal large subunit pseudouridine synthase E [EC: 5.4.99.12] (inferred from 100% identity to ddd:Dda3937_02083)

MetaCyc: 66% identical to 23S rRNA pseudouridine2457 synthase (Escherichia coli K-12 substr. MG1655)
RXN-11834 [EC: 5.4.99.20]

Predicted SEED Role

"Ribosomal large subunit pseudouridine synthase E (EC 4.2.1.70)" (EC 4.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70, 5.4.99.12

Use Curated BLAST to search for 4.2.1.70 or 5.4.99.12 or 5.4.99.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SDF3 at UniProt or InterPro

Protein Sequence (218 amino acids)

>DDA3937_RS11475 23S rRNA pseudouridine(2457) synthase RluE (Dickeya dadantii 3937)
MFLPSTASNKMNKFPVKNHRLKRFSSRPVKNESTAVTKTHIVLFNKPFDVLSQFTDEGGR
ATLKDYVPLRDIYSAGRLDRDSEGLMILTNDGKLQARLTQPGKKTPKIYYAQVEGVPDKE
ALHAFRTGLILSDGPTLPAGVEQVEEPAWLWPRQPPIRERKTIPVSWLKITLYEGRNRQV
RRMTAHIGYPTLRLIRYSMAGQTLDGLHPGEWREIDHV