Protein Info for DDA3937_RS11460 in Dickeya dadantii 3937

Annotation: protease HtpX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 33 to 53 (21 residues), see Phobius details amino acids 154 to 175 (22 residues), see Phobius details amino acids 194 to 218 (25 residues), see Phobius details PF01435: Peptidase_M48" amino acids 74 to 289 (216 residues), 131.7 bits, see alignment E=1.4e-42

Best Hits

Swiss-Prot: 88% identical to HTPX_KLEP7: Protease HtpX (htpX) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: K03799, heat shock protein HtpX [EC: 3.4.24.-] (inferred from 100% identity to ddd:Dda3937_03688)

Predicted SEED Role

"Probable protease HtpX (EC 3.4.24.-)" (EC 3.4.24.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SDF0 at UniProt or InterPro

Protein Sequence (294 amino acids)

>DDA3937_RS11460 protease HtpX (Dickeya dadantii 3937)
MMRIALFLLTNLAVMVVFGLVLSLTGVQHNSMAGLIIMAGLFGFGGSIISLLMSKWMALR
SVGGEVIEQPRDETERWLLDTVRAQSRQVGIAMPQVAIYHAPDINAFATGARRDSSLVAV
STGLLQNMSRDEAEAVIAHEISHIANGDMVTMTLVQGVVNTFVIFISRIIAQIVTGFLSG
NRDDSEESSNGNPLVYMAVSMVLELVFGILASIITMWFSRYREFHADAGSAKLVGREKMI
AALQRLKTSYEPQEASSMMAFCINGKSKSLSELFMSHPPLDKRIEALRAGEYLK