Protein Info for DDA3937_RS11425 in Dickeya dadantii 3937

Annotation: 50S ribosomal protein L35

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 65 TIGR00001: ribosomal protein bL35" amino acids 2 to 64 (63 residues), 91.5 bits, see alignment E=1.6e-30 PF01632: Ribosomal_L35p" amino acids 2 to 62 (61 residues), 85.5 bits, see alignment E=1.4e-28

Best Hits

Swiss-Prot: 97% identical to RL35_ERWT9: 50S ribosomal protein L35 (rpmI) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: K02916, large subunit ribosomal protein L35 (inferred from 94% identity to ypa:YPA_1776)

MetaCyc: 92% identical to 50S ribosomal subunit protein L35 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L35p" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SDE2 at UniProt or InterPro

Protein Sequence (65 amino acids)

>DDA3937_RS11425 50S ribosomal protein L35 (Dickeya dadantii 3937)
MPKIKTVRGAAKRFKKTASGGFKRKHANLRHILTKKATKRKRHLRPKGMVSKGDLGLVAA
CLPYA