Protein Info for DDA3937_RS11360 in Dickeya dadantii 3937

Annotation: carbohydrate ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 430 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF01547: SBP_bac_1" amino acids 45 to 332 (288 residues), 108.6 bits, see alignment E=6.7e-35 PF13416: SBP_bac_8" amino acids 45 to 353 (309 residues), 90.6 bits, see alignment E=1.5e-29

Best Hits

KEGG orthology group: K10192, oligogalacturonide transport system substrate-binding protein (inferred from 100% identity to ddd:Dda3937_04596)

Predicted SEED Role

"Sugar-binding protein precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SDC9 at UniProt or InterPro

Protein Sequence (430 amino acids)

>DDA3937_RS11360 carbohydrate ABC transporter substrate-binding protein (Dickeya dadantii 3937)
MKKVILRTLIASSLALMAHQSFAADQVDLRMSWWGGNGRHQVTLKAIEEFQKQYPNIKVK
AEYTGWDGHLSRLTTQIAGNTEPDVMQTNWNWLPIFSRTGDGFYDLNKMKDVLDLSQFEA
KELQATTVDGKLNGIPISVTARVFYYNTETWKKSGLTAPKTWDELLNAGKVFKEKLGDQS
YPLVLEHQDSLALLNSYMVQKYNIPAVDEKNKKFSYTDAQWVEFFQMYKKLVDAHVMPSA
KYYASFGKSNMYEMKPWINGDWGGTYMWNSTITKYSDNLQPPAKLELGAYPMLPGAKEAG
LFFKPAQMLSIGKSTKHPKEAAMLINYLLNSKEGIQALGLERGVPLSKAAVAQLRADGVI
KDNDPSVAGLNLALSLPHETKTSPYFDDPQIVALFGDSIQYIDYEQKSVEETAKYFQRQA
DRILKRAMKE