Protein Info for DDA3937_RS11270 in Dickeya dadantii 3937

Annotation: MCP four helix bundle domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 526 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 187 to 208 (22 residues), see Phobius details PF02203: TarH" amino acids 2 to 168 (167 residues), 27.3 bits, see alignment E=4.6e-10 PF12729: 4HB_MCP_1" amino acids 4 to 174 (171 residues), 53.2 bits, see alignment E=4.3e-18 PF00015: MCPsignal" amino acids 325 to 480 (156 residues), 186.1 bits, see alignment E=7.5e-59

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 100% identity to ddd:Dda3937_03722)

Predicted SEED Role

"Methyl-accepting chemotaxis protein I (serine chemoreceptor protein)" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SDB0 at UniProt or InterPro

Protein Sequence (526 amino acids)

>DDA3937_RS11270 MCP four helix bundle domain-containing protein (Dickeya dadantii 3937)
MNVWTVKKKLAMMIAAIIISFMVLVVFLLSRQTAITSELQRLYEKDYQAASIIGQIDGLL
TRVDINILRMIAIGDPASIAGWKSQNTENFTKVEGLLSKLKTIIDPTMAQSFDGLSSSYT
LMRKGMEHQVQAVESGDIKNASEINKNEVKGPADKTFGELSALKKAQDDLANKKVVAQQS
SDVTARIISLLAAAIVALGSVVLGAVILRGLLRQLGGEPVIAAQVVSQMAQGDLSSPIPV
KDHDHVSLLAQLQEMQSSLSGIVTSVRSNAESLATASIQISQGNQDLSQRTEEQASALQQ
TSATMEQLGSTVSNNAENARQANQLALGASTLAAEGGNMVERVIETMKGINDSSKKISDI
INVIDSIAFQTNILALNAAVEAARAGEQGRGFAVVASEVRSLAQRSANAAKEISTLITNS
VGQVEQGSQLVDETGATMTQIVAAINQVTDIVSEISASSLEQSSGVKQVGQAITQIDTVT
QQNAALVEESAAAAENLKEQAQQLVQAVAVFQVTSNAAQPRLFLGR