Protein Info for DDA3937_RS11260 in Dickeya dadantii 3937

Annotation: CoA pyrophosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 PF00293: NUDIX" amino acids 43 to 159 (117 residues), 57.5 bits, see alignment E=7.4e-20

Best Hits

Swiss-Prot: 74% identical to NUDL_PECAS: Uncharacterized Nudix hydrolase NudL (nudL) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: None (inferred from 100% identity to ddd:Dda3937_03720)

MetaCyc: 64% identical to putative NUDIX hydrolase with low 3-phosphohydroxypyruvate phosphatase activity (Escherichia coli K-12 substr. MG1655)
RXN0-6562

Predicted SEED Role

"Hypothetical nudix hydrolase YeaB" in subsystem Nudix proteins (nucleoside triphosphate hydrolases)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SDA8 at UniProt or InterPro

Protein Sequence (207 amino acids)

>DDA3937_RS11260 CoA pyrophosphatase (Dickeya dadantii 3937)
MTDATLSPLLDRTDGYRPYDLDAFITRFQLQTAPGLPVTQYHRQAAVLVPIIRRPDPCLL
LTRRSPRLRKHAGQVAFPGGAADPDDRSLIATALREAQEEVAIPPASVQILGTLPAFDSV
SGYQVTPVVGLLPENTPFHPNADEVAELFEMPLRDAFALQRYHSLDIERRQQRHRVYLSW
YRQQFVWGLTAAIIRHLALQVATSEPA