Protein Info for DDA3937_RS11240 in Dickeya dadantii 3937

Annotation: ATP-dependent DNA helicase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 639 PF00270: DEAD" amino acids 34 to 87 (54 residues), 28.6 bits, see alignment 2.2e-10 PF06733: DEAD_2" amino acids 182 to 252 (71 residues), 24.9 bits, see alignment E=2.9e-09 PF13307: Helicase_C_2" amino acids 464 to 621 (158 residues), 150.2 bits, see alignment E=1.3e-47

Best Hits

Swiss-Prot: 78% identical to YOAA_ECOLI: Probable ATP-dependent DNA helicase YoaA (yoaA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to ddd:Dda3937_03716)

MetaCyc: 78% identical to ATP-dependent DNA helicase YoaA (Escherichia coli K-12 substr. MG1655)
RXN0-4261 [EC: 5.6.2.3]

Predicted SEED Role

"DinG family ATP-dependent helicase YoaA" in subsystem DNA repair, bacterial DinG and relatives

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.6.2.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SDA4 at UniProt or InterPro

Protein Sequence (639 amino acids)

>DDA3937_RS11240 ATP-dependent DNA helicase (Dickeya dadantii 3937)
MAADSSIDDFATDGVLAQAIRGFQPREPQRQMAAAVLEAIDAKKPLVVEAGTGTGKTYAY
LAPALRSGKKVIVSTGSRALQDQLYSRDLPTVANALNFQGKLALLKGRSNYLCIERLEQQ
SLAGGDLGRDVLRELVRLRGWSSETEDGDISQCGDVAEDSPVWPLVTSTNDNCLGSDCPH
YKECFVVKARRRAMDADVVVVNHHLYLADMVVKESGFAELIPDSDVVIFDEAHQIPDIAS
QYFGQQLSSRQLLDLAKDIVIAYRTEVRDASQLQKSADRLSQSTQDFRLALGDPGFRGNL
RDIVTDNMLQRSLTLLDDALELCCDVAKLSLGRSALLDAAFERATLYRARLKRLRDVQQP
GYSYWYECNSRHFVLALTPLSVADRFRDVMKEKPACWVFTSATLSVNDQLTHFIDRLGLD
QARTLLLPSPFDYARQALLCVPRYLPETNRPGAAKQLARMLRPLIEANQGRCFMLCTSHQ
MMRDLAAEFRASLTLPVLVQGETSKPQLLAQFLAAGNALLVATGSFWEGVDVRGDALSCV
IIDKLPFTSPDDPLLKARMEDCRVRGGDPFDEVQLPDAVITLKQGVGRLIRDVEDRGVLV
ICDNRLVTRPYGEVFLTSLPPAPRTRDLRQAIDFLTRKP