Protein Info for DDA3937_RS11205 in Dickeya dadantii 3937

Annotation: septum site-determining protein MinC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 237 TIGR01222: septum site-determining protein MinC" amino acids 6 to 235 (230 residues), 230 bits, see alignment E=1.5e-72 PF05209: MinC_N" amino acids 6 to 74 (69 residues), 74 bits, see alignment E=8.2e-25 PF03775: MinC_C" amino acids 131 to 223 (93 residues), 103.1 bits, see alignment E=7.6e-34

Best Hits

Swiss-Prot: 76% identical to MINC_PECCP: Probable septum site-determining protein MinC (minC) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K03610, septum site-determining protein MinC (inferred from 100% identity to ddd:Dda3937_02920)

Predicted SEED Role

"Septum site-determining protein MinC" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SD98 at UniProt or InterPro

Protein Sequence (237 amino acids)

>DDA3937_RS11205 septum site-determining protein MinC (Dickeya dadantii 3937)
MSQTPIELKGSNFTLSVVHLHDAQPDIIHQALQEKIEQAPAFLKNAPVVVNVSALPVDAD
WIKLQQAITAAGLRVVGVSGCDDEQLRLSIAKAGLPLLREGKLREGKLREDKERRTTQPP
VPAAAPVKTRVINTPVRSGQQIYARDCDLIVTSHVSAGAEVIADGNIHIYGMMRGRALAG
VSGDVDSQIFCTHLAAELVSIAGRYWLSDQIPENYFGKAARLKLSPPDHVLTIQPLD