Protein Info for DDA3937_RS11190 in Dickeya dadantii 3937

Annotation: YcgN family cysteine cluster protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 153 PF03692: CxxCxxCC" amino acids 29 to 97 (69 residues), 41.5 bits, see alignment E=8.7e-15

Best Hits

Swiss-Prot: 80% identical to Y1943_PECCP: UPF0260 protein PC1_1943 (PC1_1943) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K09160, hypothetical protein (inferred from 99% identity to ddd:Dda3937_02923)

Predicted SEED Role

"YcgN (Fragment)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SCR3 at UniProt or InterPro

Protein Sequence (153 amino acids)

>DDA3937_RS11190 YcgN family cysteine cluster protein (Dickeya dadantii 3937)
MGIAVMTQKPFWETQTLEQMSDDEWEALCDGCGRCCLHKLIDEDTDELYFTNVACNQLNI
KSCQCRNYARRFEYEPDCIKLTRENLLSFDWLPETCAYRLIHEGKGLQPWHPLLAGSKAA
MHQQRISVRNIAVRESEVMDWQDHILNKPEWAR