Protein Info for DDA3937_RS11035 in Dickeya dadantii 3937

Annotation: redox-regulated ATPase YchF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00092: GTP-binding protein YchF
  • amino acids 1 to 363 (363 residues), 578.5 bits, E=2.9e-178
• PF01926: MMR_HSR1
  • amino acids 5 to 109 (105 residues), 71.7 bits, E=8.2e-24
• PF02421: FeoB_N
  • amino acids 5 to 45 (41 residues), 32.8 bits, 7.1e-12
• PF06071: YchF-GTPase_C
  • amino acids 279 to 362 (84 residues), 133.6 bits, E=3.3e-43

Best Hits

Swiss-Prot: 94% identical to YCHF_SHIFL: Ribosome-binding ATPase YchF (ychF) from Shigella flexneri

KEGG orthology group: K06942, (no description) (inferred from 100% identity to ddd:Dda3937_02958)

MetaCyc: 94% identical to redox-responsive ATPase YchF (Escherichia coli K-12 substr. MG1655)
Nucleoside-triphosphatase. [EC: 3.6.1.15, 3.6.1.5]

Predicted SEED Role

"GTP-binding and nucleic acid-binding protein YchF" in subsystem Universal GTPases

MetaCyc Pathways

• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (18/18 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (14/14 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis I (9/9 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis III (8/9 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis IV (6/7 steps found)
• pyrimidine deoxyribonucleotides biosynthesis from CTP (6/8 steps found)
• UTP and CTP dephosphorylation I (5/7 steps found)
• UTP and CTP dephosphorylation II (1/3 steps found)

KEGG Metabolic Maps

• Purine metabolism
• Pyrimidine metabolism
• Thiamine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.15

Use Curated BLAST to search for 3.6.1.15 or 3.6.1.5

Sequence Analysis Tools

See E0SCM3 at UniProt or InterPro

Protein Sequence (363 amino acids)

>DDA3937_RS11035 redox-regulated ATPase YchF (Dickeya dadantii 3937)
MGFKCGIVGLPNVGKSTLFNALTKAGIEAANFPFCTIEPNTGVVPMPDLRLDQLAEIVKP
QRTVPTTMEFVDIAGLVKGASKGEGLGNQFLTNIRETEAIGHVVRCFENENIIHVAGKVN
PADDIDTINTELALSDLDTCERALHRVQKKAKGGDKDAKVEQAALEKCLPQLENAGMLRA
LDLSAEEKAAIRYLSFLTLKPTMYIANVNEDGFENNPYLDQVREIAAREGSVVVPVCAAV
ESDIAELDDEERDEFMAELGLEEPGLNRVIRAGYELLNLQTYFTAGVKEVRAWTIPVGAT
APQAAGKIHTDFEKGFIRAQTIAFDDFITYKGEQGAKEAGKMRSEGKEYIVKDGDIMNFL
FNV