Protein Info for DDA3937_RS11025 in Dickeya dadantii 3937

Annotation: stress-induced protein YchH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 89 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 42 to 60 (19 residues), see Phobius details PF10762: DUF2583" amino acids 1 to 88 (88 residues), 157 bits, see alignment E=6.9e-51

Best Hits

Swiss-Prot: 60% identical to YCHH_ECOLI: Uncharacterized protein YchH (ychH) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to ddd:Dda3937_00478)

Predicted SEED Role

"FIG00554739: membrane protein YchH"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SCM1 at UniProt or InterPro

Protein Sequence (89 amino acids)

>DDA3937_RS11025 stress-induced protein YchH (Dickeya dadantii 3937)
MKRRNAVMMGNVFMGLGMLLMIAGIAYSIANQLPELNLPGSLYYVELLAIFAGAILWLAG
ARISGRENVTDRYWWLKHFDKRCRRERHP