Protein Info for DDA3937_RS10940 in Dickeya dadantii 3937

Annotation: FIST C-terminal domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 647 PF08495: FIST" amino acids 43 to 241 (199 residues), 63.6 bits, see alignment E=3.4e-21 PF10442: FIST_C" amino acids 265 to 381 (117 residues), 50.3 bits, see alignment E=4e-17 PF00015: MCPsignal" amino acids 480 to 640 (161 residues), 97.6 bits, see alignment E=1.2e-31

Best Hits

KEGG orthology group: None (inferred from 100% identity to ddd:Dda3937_01627)

Predicted SEED Role

"Methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SCK2 at UniProt or InterPro

Protein Sequence (647 amino acids)

>DDA3937_RS10940 FIST C-terminal domain-containing protein (Dickeya dadantii 3937)
MSSFLSHIAIPGLKRNRPARGAYRCDALPSSLSALGLPSKPGLLLVFVPPEANFSEVNRA
WQRFSAPHRTVITLSSTGALCSQRNNSTYCDMNGPYGSWLWMPQSLLAKHEVHLVDLHMH
DKPSARARIDAIRQELERLDVSLPLSSDNTFALIYCDGLAASEGFLMQAWYACRRFPCLT
IGGAAGGRLDFSGTYIGADNTVLQGKAVIVFCQMAPGKSFAPFKSQNFDPTKQSWLVAEA
DPVARTVKSVFDANGHEQPIIEAIASCLRCPPNQISQHLTGKTFAVKVNDEYFVRSVASI
KEDRIAFFCDLEFGDRLYLMQSTDFIATTERDWQQFISQYGKPDLVLLNDCVLRRAGNPN
LEQAQFFDQVPAAGFSSFGEILGVPINQTLSALAFFSRDVKAMTHFPVEYAAYAGHYAQR
SLRRWEALHDIQSAVVKQVVDYEQALAPLLTAMPQLEQATLRQSDTLDVAQTSIRAISES
AAKTQEAQIRLETGLNDLERISKGISHITSGINAIADKTNLLALNAAVEAARAGEAGRGF
AVVADEVRKLASSSKEQVDATTHSINEAVETIAHIRTIAQQTVTTTTQMADKSISAANQI
ADMSAETEKDRSNMTANLGNLKDLAKGMDAMQDAVNQLTTLQKLASS