Protein Info for DDA3937_RS10765 in Dickeya dadantii 3937

Annotation: MCE family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 556 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details PF02470: MlaD" amino acids 44 to 135 (92 residues), 51.3 bits, see alignment E=5.8e-18 amino acids 159 to 219 (61 residues), 34.7 bits, see alignment E=8.7e-13 amino acids 291 to 403 (113 residues), 36 bits, see alignment E=3.3e-13

Best Hits

KEGG orthology group: K06192, paraquat-inducible protein B (inferred from 100% identity to ddd:Dda3937_00477)

Predicted SEED Role

"Paraquat-inducible protein B" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SC23 at UniProt or InterPro

Protein Sequence (556 amino acids)

>DDA3937_RS10765 MCE family protein (Dickeya dadantii 3937)
MNPMLPGEITAIRRSWRHAAIWFVPVIALAISLAMLVQSRLSAGPDITLSFRSATGLEAG
KTTVKYKDVTVGIVKDIVINDDGSRVLVRVQLNKNAENLARSGSRFWVVRPRVGMSGVSG
IDTLLSGAYIGVDKGYSSETRREFTGLETPPAIINDMPGSHFVIDADDLGSLDIGSPVYY
RRVQVGRLAPYHLKEDGRGVSLQVFIDAPYDRLVQPDTRFWNVSGVDLSVGANGFRLKTQ
TVAAVLAGGIAFATPESNKDSDKTPAINSPVSYRLAPDQESAMSAPDGQAIPFRLRFERA
LHGLDIGAPVEFSSVTIGRVTAITLDYNPTGYRFPTIVDVEVYPARLGNLLDKLPGSSPS
ESPSPVETVNKAALFTRDLVAHGLRAQAVPGNLLTGQLYVSFDFVPDAPNVRFNPNARPI
ELPTVSGGLDKLQAQLGGIVAKVNNMPLESIGNNLNNTLVELNKTLRLVNNQTLPTANSL
MKQTQLTTENAQELIAEDSPLLIHFTQTLQEASRTLRTLREFTEQLERNPESLLRGRSSD
SAPNAADDRSASPKGK