Protein Info for DDA3937_RS10740 in Dickeya dadantii 3937

Annotation: ClbS/DfsB family four-helix bundle protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 172 PF08020: DUF1706" amino acids 1 to 165 (165 residues), 178.8 bits, see alignment E=4.2e-57

Best Hits

KEGG orthology group: None (inferred from 78% identity to eum:p1ECUMN_0142)

MetaCyc: 51% identical to colibactin cyclopropane hydrolase (Escherichia coli IHE3034)
RXN-21171

Predicted SEED Role

"DUF1706 domain-containing protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (172 amino acids)

>DDA3937_RS10740 ClbS/DfsB family four-helix bundle protein (Dickeya dadantii 3937)
MGVPQTKSELLFAIDKNFTKLIGYLNAIPPELTADKSLDGHAKGTEMSVCELVSYLLGWN
TLVVKWISGDATGQPVDFPETGYKWNQLGLLAQKFYFDYKELNYQTLINNLQSVKDEIVR
LIDERTDEDLYGKPWYGKWTMGRMISLNTSSPYANANGRLRQWAKNNHLRLK