Protein Info for DDA3937_RS10700 in Dickeya dadantii 3937

Annotation: class I SAM-dependent methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 PF01209: Ubie_methyltran" amino acids 10 to 159 (150 residues), 75.7 bits, see alignment E=2.4e-24 PF00891: Methyltransf_2" amino acids 14 to 190 (177 residues), 25.4 bits, see alignment E=5.5e-09 PF05148: Methyltransf_8" amino acids 36 to 154 (119 residues), 27.1 bits, see alignment E=2.3e-09 PF05175: MTS" amino acids 37 to 169 (133 residues), 33.6 bits, see alignment E=1.9e-11 PF03141: Methyltransf_29" amino acids 38 to 145 (108 residues), 31.3 bits, see alignment E=5.7e-11 PF13489: Methyltransf_23" amino acids 41 to 194 (154 residues), 64 bits, see alignment E=9.2e-21 PF06325: PrmA" amino acids 44 to 151 (108 residues), 22.6 bits, see alignment E=4.3e-08 PF13847: Methyltransf_31" amino acids 45 to 156 (112 residues), 84.8 bits, see alignment E=3.6e-27 PF03848: TehB" amino acids 46 to 140 (95 residues), 21.3 bits, see alignment E=1e-07 PF13649: Methyltransf_25" amino acids 49 to 142 (94 residues), 91 bits, see alignment E=4.4e-29 PF08242: Methyltransf_12" amino acids 50 to 142 (93 residues), 60.7 bits, see alignment E=1.2e-19 PF08241: Methyltransf_11" amino acids 50 to 145 (96 residues), 97.6 bits, see alignment E=3.5e-31

Best Hits

KEGG orthology group: None (inferred from 100% identity to ddd:Dda3937_04135)

Predicted SEED Role

"SAM-dependent methyltransferase YafE (UbiE paralog)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SC09 at UniProt or InterPro

Protein Sequence (256 amino acids)

>DDA3937_RS10700 class I SAM-dependent methyltransferase (Dickeya dadantii 3937)
MESSKSHQQSVEKQFGEQANAYLSSAVHAQGEDLVELARRLKGKNHVSVLDLGCGAGHVS
FTVASLVGNVVACDLSPRMLDVVASAAQEKGLTNIRTQQAMAESLPFADDSFDVVISRYS
AHHWQDVGQALREVKRVLKPEGEAILMDVISPGHPVLDVYLQTVEMLRDTSHVRNYTPGE
WLTLLSEAGLTVRSLQTSRLHLEFQSWVTRMRTPEHFVTAIRALQQQMSAEVIRHYDIRQ
DGSFTTDIAFIVASQG