Protein Info for DDA3937_RS10690 in Dickeya dadantii 3937

Annotation: DUF1283 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 118 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF06932: DUF1283" amino acids 29 to 118 (90 residues), 135.2 bits, see alignment E=3.7e-44

Best Hits

Swiss-Prot: 53% identical to Y1468_SODGM: UPF0482 protein SG1468 (SG1468) from Sodalis glossinidius (strain morsitans)

KEGG orthology group: None (inferred from 100% identity to ddd:Dda3937_04133)

Predicted SEED Role

"putative secreted protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SC07 at UniProt or InterPro

Protein Sequence (118 amino acids)

>DDA3937_RS10690 DUF1283 family protein (Dickeya dadantii 3937)
MQKKTRNLLLLLTSSLFSLSLLQSAQAAQHIIIDNGNSALSKEAARQSSEDWNETRTLRN
KLNKHLEKRVDKADRDFDKADMAEALEEKCKASSNFNAYWEPSSSRCLDRRSGRPVTP