Protein Info for DDA3937_RS10405 in Dickeya dadantii 3937

Annotation: cardiolipin synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 486 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 37 to 58 (22 residues), see Phobius details amino acids 150 to 168 (19 residues), see Phobius details TIGR04265: cardiolipin synthase" amino acids 6 to 486 (481 residues), 642.9 bits, see alignment E=2e-197 PF13396: PLDc_N" amino acids 23 to 59 (37 residues), 33.3 bits, see alignment 5.7e-12 PF13091: PLDc_2" amino acids 134 to 242 (109 residues), 44.1 bits, see alignment E=2.7e-15 amino acids 328 to 446 (119 residues), 91.1 bits, see alignment E=8.2e-30 PF00614: PLDc" amino acids 219 to 246 (28 residues), 29.8 bits, see alignment (E = 6.4e-11) amino acids 400 to 426 (27 residues), 25.5 bits, see alignment (E = 1.5e-09)

Best Hits

Swiss-Prot: 83% identical to CLSA_PECCP: Cardiolipin synthase A (clsA) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K06131, cardiolipin synthase [EC: 2.7.8.-] (inferred from 100% identity to ddd:Dda3937_00561)

MetaCyc: 76% identical to cardiolipin synthase A (Escherichia coli K-12 substr. MG1655)
CARDIOLIPSYN-RXN [EC: 2.7.8.41]

Predicted SEED Role

"Cardiolipin synthetase (EC 2.7.8.-)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.-

Use Curated BLAST to search for 2.7.8.- or 2.7.8.41

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SBE8 at UniProt or InterPro

Protein Sequence (486 amino acids)

>DDA3937_RS10405 cardiolipin synthase (Dickeya dadantii 3937)
MTAFYTVLSGLLVFSYWLLVASITLRILMKRRAVPSAMAWLLVIYILPLVGIVAYLLFGE
LHLGKQRAERARQMWPVTAQWLRELKEYRRIFATENSEVARSLFQLCERRQGISGIKGNQ
LQLLASFDDTIRTLIRDIELARNNIEMVFYIWQAGGLVDQVMTALLAASRRGVKCRILLD
SAGSVQFFHSTYPEIMRAADITVVDALQVNLLRAFLRRMDLRQHRKVILIDNRIAYTGSM
NMVDPRYFKQDSGVGQWVDLMVRIEGPVTTTMGVIYSLDWEMETGQRLPPPPPDVNIMPF
EQERGHTVQVIASGPGYPEDMIHQALLTAVYSARHQLIMTTPYFVPSDDLQHAICTAAQR
GVDVSVIVPYKNDSMMVGWACKAFFTELLAAGVKIYQFEGGLLHTKSVLVDGQLSLVGTV
NLDMRSLWLNFEITLVIDDDEFGSDLACVHEDYMSRSRLLNAKEWLKRPYWQRIVERLFY
FFSPLL