Protein Info for DDA3937_RS10330 in Dickeya dadantii 3937

Annotation: YchJ family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 155 PF17775: YchJ_M-like" amino acids 30 to 130 (101 residues), 109.1 bits, see alignment E=1.7e-35 PF02810: SEC-C" amino acids 137 to 154 (18 residues), 40.1 bits, see alignment (E = 2.7e-14)

Best Hits

Swiss-Prot: 65% identical to Y2332_PECAS: UPF0225 protein ECA2332 (ECA2332) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K09858, SEC-C motif domain protein (inferred from 100% identity to ddd:Dda3937_04045)

Predicted SEED Role

"UPF0225 protein YchJ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SBD3 at UniProt or InterPro

Protein Sequence (155 amino acids)

>DDA3937_RS10330 YchJ family protein (Dickeya dadantii 3937)
MSECCPCGSDQPYEHCCQPYLRRDAQAPRPDLLMRSRYSAYVKQDIDYLVDTWHPDCHAE
NWRADITTSCTDTHWLGLRILDVAPGKTADEGYVEFAASYSAAGHPDRRVLMRERSRFLR
YRDRWYYVDGVHLQTGRNDACPCGSGKKYKKCCGQ