Protein Info for DDA3937_RS10325 in Dickeya dadantii 3937

Annotation: formyltetrahydrofolate deformylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 TIGR00655: formyltetrahydrofolate deformylase" amino acids 9 to 282 (274 residues), 432.6 bits, see alignment E=3.8e-134 PF01842: ACT" amino acids 10 to 69 (60 residues), 30.8 bits, see alignment E=1.9e-11 PF00551: Formyl_trans_N" amino acids 88 to 264 (177 residues), 189.6 bits, see alignment E=4.4e-60

Best Hits

Swiss-Prot: 88% identical to PURU_ECOLI: Formyltetrahydrofolate deformylase (purU) from Escherichia coli (strain K12)

KEGG orthology group: K01433, formyltetrahydrofolate deformylase [EC: 3.5.1.10] (inferred from 100% identity to ddd:Dda3937_04046)

MetaCyc: 88% identical to formyltetrahydrofolate deformylase (Escherichia coli K-12 substr. MG1655)
Formyltetrahydrofolate deformylase. [EC: 3.5.1.10]

Predicted SEED Role

"Formyltetrahydrofolate deformylase (EC 3.5.1.10)" in subsystem One-carbon metabolism by tetrahydropterines (EC 3.5.1.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SBD2 at UniProt or InterPro

Protein Sequence (283 amino acids)

>DDA3937_RS10325 formyltetrahydrofolate deformylase (Dickeya dadantii 3937)
MQSQNIQRKILRTICPDAKGLIAKITNICYKHELNIVQNSEYVDHRTGRFFMRTELEGIF
NDTTLQADLDSALPEGSVRELTSAGRRRVVILVTKEAHCLGDLLMKSAYGGLDVEIAAVI
GNHETLRTLVERFDIPFHLVSHEGLTREEHDLKMIAQIDQYKPDYVVLAKYMRVLTPAFV
QNYPNRVINIHHSFLPAFIGARPYHQAYERGVKIIGATAHYVNDNLDEGPIIMQDVIHVD
HTYTADDMMRAGRDVEKNVLSRALYHVLAQRVFVYGNRTIILR