Protein Info for DDA3937_RS10315 in Dickeya dadantii 3937

Annotation: trimeric intracellular cation channel family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 206 transmembrane" amino acids 28 to 50 (23 residues), see Phobius details amino acids 62 to 80 (19 residues), see Phobius details amino acids 87 to 108 (22 residues), see Phobius details amino acids 114 to 135 (22 residues), see Phobius details amino acids 147 to 162 (16 residues), see Phobius details amino acids 174 to 197 (24 residues), see Phobius details PF03458: Gly_transporter" amino acids 5 to 78 (74 residues), 77.3 bits, see alignment E=3.4e-26 amino acids 90 to 162 (73 residues), 81.8 bits, see alignment E=1.3e-27

Best Hits

Swiss-Prot: 50% identical to Y1240_HAEIN: UPF0126 membrane protein HI_1240 (HI_1240) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 99% identity to dze:Dd1591_2205)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SBD1 at UniProt or InterPro

Protein Sequence (206 amino acids)

>DDA3937_RS10315 trimeric intracellular cation channel family protein (Dickeya dadantii 3937)
MLTYIYLIAITAEGMSGALAAGRRNMDIFGVSMIAFITALGGGTVRDILLGNYPIVWTQH
PVYIYLTIGAGLLAVLAARVMHHLHRLFLVLDAMGLVAFTIIGCNVAIELGYSPTVVVMA
GITTGIFGGILRDIFCNRTPMVLRKELYACVSLLVALVYLGLREIGINHDLNQLISFSVG
LALRLAAIFWSWQLPVFSYMPERWKE