Protein Info for DDA3937_RS10280 in Dickeya dadantii 3937
Annotation: bifunctional nicotinamidase/pyrazinamidase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 62% identical to PNCA_ECOLI: Nicotinamidase (pncA) from Escherichia coli (strain K12)
KEGG orthology group: K08281, nicotinamidase/pyrazinamidase [EC: 3.5.1.- 3.5.1.19] (inferred from 100% identity to ddd:Dda3937_04576)MetaCyc: 62% identical to nicotinamidase (Escherichia coli K-12 substr. MG1655)
Amidase. [EC: 3.5.1.4]; Nicotinamidase. [EC: 3.5.1.4, 3.5.1.19]
Predicted SEED Role
"Nicotinamidase (EC 3.5.1.19)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation or Redox-dependent regulation of nucleus processes (EC 3.5.1.19)
MetaCyc Pathways
- indole-3-acetate biosynthesis III (bacteria) (2/2 steps found)
- NAD salvage pathway I (PNC VI cycle) (5/7 steps found)
- acrylonitrile degradation I (1/2 steps found)
- indole-3-acetate biosynthesis IV (bacteria) (1/2 steps found)
- NAD salvage pathway V (PNC V cycle) (3/5 steps found)
- L-arginine degradation X (arginine monooxygenase pathway) (1/3 steps found)
- aldoxime degradation (1/3 steps found)
- superpathway of acrylonitrile degradation (1/3 steps found)
- NAD salvage (plants) (5/11 steps found)
- superpathway of NAD biosynthesis in eukaryotes (7/14 steps found)
- indole-3-acetate biosynthesis II (4/12 steps found)
KEGG Metabolic Maps
- 1,4-Dichlorobenzene degradation
- Arginine and proline metabolism
- Benzoate degradation via CoA ligation
- Biosynthesis of plant hormones
- Caprolactam degradation
- Cyanoamino acid metabolism
- Glutathione metabolism
- Lipopolysaccharide biosynthesis
- Lysine biosynthesis
- Nicotinate and nicotinamide metabolism
- Nucleotide sugars metabolism
- Phenylalanine metabolism
- Sphingolipid metabolism
- Styrene degradation
- Tryptophan metabolism
- Urea cycle and metabolism of amino groups
Isozymes
Compare fitness of predicted isozymes for: 3.5.1.-, 3.5.1.4
Use Curated BLAST to search for 3.5.1.- or 3.5.1.19 or 3.5.1.4
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See E0SBC4 at UniProt or InterPro
Protein Sequence (213 amino acids)
>DDA3937_RS10280 bifunctional nicotinamidase/pyrazinamidase (Dickeya dadantii 3937) MNRALLLVDIQNDFCAGGALAVSDGDSVVAVANQAIAACQQAGVTIIACQDWHPADHRSF AVNSGTQVGDVGELDGLPQIWWPVHCVQGSPGADFHPGLNQQAINWVVRKGTHPFIDSYS AFFDNGRRTRTELYDWLKARDITRLTIMGLATDYCVKYTVLDALALGYQTEVLTDGCRGV NLHPKDSQQALEVMAKHGATLLELPAFIASLSQ