Protein Info for DDA3937_RS10230 in Dickeya dadantii 3937

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 PF00005: ABC_tran" amino acids 18 to 167 (150 residues), 93.3 bits, see alignment E=1.1e-30

Best Hits

KEGG orthology group: K02031, peptide/nickel transport system ATP-binding protein (inferred from 100% identity to ddd:Dda3937_03328)

Predicted SEED Role

"Oligopeptide transport ATP-binding protein OppD (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SBB4 at UniProt or InterPro

Protein Sequence (267 amino acids)

>DDA3937_RS10230 ABC transporter ATP-binding protein (Dickeya dadantii 3937)
MLDVRQLTLSIDGSRKIHDVSFSLAPGERVCLLGGSGSGKSLTARCLLGALPIGSQLSGS
IRLQGHDVAGLPLSRRPPDERPAAIFQDSATSLNPLFTIEAQLRMALKRQPTHRSLPDLL
RSVGFADPHTVLARYPGELSGGQRQRLCIALALLCERPLLIADEPTTALDVVTQAQVLHT
LLARLQQSPHTGLLFITHDITVAAMICQRALVMENGRLVEQGEMRRLLTHPRHSYTRALV
SAARQASAGAAFSRQSRMPFAPCAQAS