Protein Info for DDA3937_RS09370 in Dickeya dadantii 3937

Annotation: GTP cyclohydrolase I FolE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 TIGR00063: GTP cyclohydrolase I" amino acids 39 to 219 (181 residues), 281.1 bits, see alignment E=1.5e-88 PF01227: GTP_cyclohydroI" amino acids 39 to 217 (179 residues), 208.2 bits, see alignment E=3.5e-66

Best Hits

Swiss-Prot: 92% identical to GCH1_PECCP: GTP cyclohydrolase 1 (folE) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K01495, GTP cyclohydrolase I [EC: 3.5.4.16] (inferred from 100% identity to ddd:Dda3937_03497)

MetaCyc: 90% identical to GTP cyclohydrolase 1 (Escherichia coli K-12 substr. MG1655)
GTP cyclohydrolase I. [EC: 3.5.4.16]

Predicted SEED Role

"GTP cyclohydrolase I (EC 3.5.4.16) type 1" in subsystem Folate Biosynthesis or Molybdenum cofactor biosynthesis or Pterin biosynthesis or Queuosine-Archaeosine Biosynthesis (EC 3.5.4.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SMS6 at UniProt or InterPro

Protein Sequence (222 amino acids)

>DDA3937_RS09370 GTP cyclohydrolase I FolE (Dickeya dadantii 3937)
MSAVLTKEAALVHEALLARGLETPLRGKMLESETRKRLIAEHMTEIMNLLNLDLADDSLA
ETPHRIAKMYVEEIFSGLDYANFPKITIIENKMKVDEMVTVRDITLTSTCEHHFVTIDGK
ATVAYIPKEGVIGLSKINRIVQFFSQRPQVQERLTQQILVALQTLLGTNNVAVSIDAVHY
CVKARGIRDATSATTTTSLGGLFKSSQNTRQEFLRAVRHHHN